PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA20G00053
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 547aa    MW: 61896.7 Da    PI: 10.2107
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA20G00053genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.35.7e-07401455862
                 HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                 +r   NR +A rs +++ +++  Le+kv++L++e ++L  +   ++ e+ +l+  
  AA20G00053 401 KRIFDNRRSAARSKEKRTKYMFDLEQKVQTLQKEVTTLSAQCTAMEREMMNLTER 455
                 66678**********************************9999999888888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-10394458IPR004827Basic-leucine zipper domain
PfamPF077165.7E-10395448IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.082396459IPR004827Basic-leucine zipper domain
CDDcd147032.79E-13400448No hitNo description
SuperFamilySSF579598.84E-9400453No hitNo description
Gene3DG3DSA:1.20.5.1704.4E-9402453No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MSDRTETMQR MCSSFGTSQT SIPQNLMNQN PQLNPNLIRP QFPQFSHPFS GFQAANGGVN  60
GAPPPYPITT PPYSQIPMNH QQNSQNFNHS RSISQPTSVF SLDSLPPLSP SPFQRSLPFP  120
ATSMAKNMAA RDVSMEVRDS INGLPPLSNS VFSRNAHRRS MSEVTNGLNP MIPQQIPYQR  180
SISGGQFTDW SKAAPLVKKE AEEQKKSEKE AIDELFSTFI NLDNIDVLNS SEANDNKNKE  240
TLNKKENRVN ESGNKKGSLK RRAINNGGDL EAMNTHYRSD SVDNSTTQKL SLNKEFPKPP  300
PSPRSLLRKT SSPMTSIDEN SDTSSLKVQK TEFTPLMANE EVTEMELFSP GKASPKTSIG  360
RKRRTVSLNT KKPEFTALEM RKIMANDRLS ELLKTDPPLV KRIFDNRRSA ARSKEKRTKY  420
MFDLEQKVQT LQKEVTTLSA QCTAMEREMM NLTERNRNLN YRIQSMKKQE QLQEALNDSL  480
AAEVNRLKLV VEGSYNRFGA GNDPNRSQMQ SLNPEMLLQE LNTGQFRYPQ MQFQNQNRPM  540
PQPDLNH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.36e-71bZIP family protein